DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and gst2

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:179 Identity:50/179 - (27%)
Similarity:77/179 - (43%) Gaps:35/179 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMND---EGLVLWE 88
            ||.....|....::|..|.|::.:|....:..:|||...:.:|:||...|||:.|   ....:||
pombe     6 LYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNNDYTIWE 70

  Fly    89 SRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYF---------------P 138
            |.|||.||      :|: |.||.::      .|.|| ...|.:|..|.|               .
pombe    71 SDAILIYL------ADK-YDTDRKI------SLSFD-DPEYYKLIQYLFFQASGQGVIWGQAGWF 121

  Fly   139 TMFIGAPLDEG---KRAKLAEAVGWLNTILEGRQFSAADHFTIADLTLL 184
            ..|...|:...   .|.::...:|.|..||:.|.:..|:.:|||||:.:
pombe   122 NFFHHEPVVSAVTRYRNEIKRVLGVLEDILKDRDYLVANKYTIADLSFI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 25/73 (34%)
GST_C_Delta_Epsilon 112..231 CDD:198287 21/91 (23%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 27/84 (32%)
GstA 5..226 CDD:223698 50/179 (28%)
GST_C_Ure2p 96..219 CDD:198326 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.