DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and gst1

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:162 Identity:50/162 - (30%)
Similarity:76/162 - (46%) Gaps:13/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMND---EGLVLWESRAIL 93
            |:|  ..::...|.||:.:|.:.||..:.||..|:.:|:||...|||:.|   ....:|||.|||
pombe    13 PNP--WKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNNDYTIWESDAIL 75

  Fly    94 SYLVAAYGKSDQL-YPTDIRVRALVDQRLQFDL---GTLYMRL--TDYYFPTMFIGAPLDEGKRA 152
            .||...|....:: .|.|......|.|.|.|..   |.::.:.  ...|...:.|.|  ....|.
pombe    76 IYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYHQELVISA--ITRYRN 138

  Fly   153 KLAEAVGWLNTILEGRQFSAADHFTIADLTLL 184
            ::...:|.|..||:.|.:..|:.||||||:.:
pombe   139 EIKRVLGVLEDILKDRDYLVANRFTIADLSFI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 26/68 (38%)
GST_C_Delta_Epsilon 112..231 CDD:198287 21/78 (27%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 27/72 (38%)
GstA 5..218 CDD:223698 50/162 (31%)
GST_C_Ure2p 96..219 CDD:198326 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.