DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GstE9

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:226 Identity:83/226 - (36%)
Similarity:121/226 - (53%) Gaps:13/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GKMSPPVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGL 84
            ||:   |||.:..|||.|:..|....|.:.:|.::||:|.||....:|...||||.||.:.|:|.
  Fly     2 GKL---VLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGK 63

  Fly    85 VLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMR-LTDYYFPTMFIGAPLDE 148
            .:|||.||.:|||..|.|||.|||.|...||||||||.|:.|.|:.. :.:...|..:  ..:.|
  Fly    64 FIWESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFY--KNITE 126

  Fly   149 GKRAK---LAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAF-EFELRPYKHIRQWLDR 209
            ..|::   :.||..:|...:..:.:......||||.:::.:||.|... ..:.:.|..:..||||
  Fly   127 VPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDR 191

  Fly   210 CKDHMAPFDYEELNANKANMLADMFKAKMNQ 240
            .   .|..:|:.||.|.|.||.|||.:|:.:
  Fly   192 M---AAQPNYQSLNGNGAQMLIDMFSSKITK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 112..231 CDD:198287 36/123 (29%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 71/204 (35%)
GST_N_Delta_Epsilon 4..76 CDD:239343 30/74 (41%)
GST_C_Delta_Epsilon 92..209 CDD:198287 35/121 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.