DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and AIMP3

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:178 Identity:40/178 - (22%)
Similarity:68/178 - (38%) Gaps:36/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLVAAYGKSD--QLY 107
            |.|:....||.|.|   .:.|..|.:|.:..|...:.:...:....:||..| |:..||:  |..
  Fly     1 MCDVATVQKIANCL---GVNPGKVQLNEEQVVTRTSGQKKSVAGFASILESL-ASESKSETAQNS 61

  Fly   108 PTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGK---RAKLAEAVGWLNTILEGRQ 169
            .....|.|.|.|.::|.:  ||:             ||..:.|   :..||:    .|.:...:.
  Fly    62 RASREVEAQVYQWIEFSV--LYV-------------APGSKDKYVSKQLLAD----FNKLFASKS 107

  Fly   170 FSAADHFTIADLTLLVTVSQLEAFEFELRP-----YKHIRQWLDRCKD 212
            :......|:|||.:...:..|..   .|.|     |.::.:|.|..::
  Fly   108 YLVGHFITLADLAVYYAIYDLVK---SLSPVDKEVYLNLSRWFDHLQN 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 13/52 (25%)
GST_C_Delta_Epsilon 112..231 CDD:198287 23/109 (21%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 23/110 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.