Sequence 1: | NP_001138040.1 | Gene: | GstD11 / 41512 | FlyBaseID: | FBgn0038029 | Length: | 243 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491070.1 | Gene: | gst-43 / 190586 | WormBaseID: | WBGene00001791 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 49/197 - (24%) |
---|---|---|---|
Similarity: | 83/197 - (42%) | Gaps: | 26/197 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 MSPPVLY-YLPPSPPCRSILLLAKMLDIDFELKIVNIL-EGEQLKPDFVAMNPQHCVPTMNDEGL 84
Fly 85 VLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEG 149
Fly 150 KRAKLAEAVGWLNTIL-------------EGRQFSAADHFTIADLTLLVTVSQLEAFEFELRPYK 201
Fly 202 HI 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD11 | NP_001138040.1 | GST_N_Delta_Epsilon | 25..98 | CDD:239343 | 28/74 (38%) |
GST_C_Delta_Epsilon | 112..231 | CDD:198287 | 17/105 (16%) | ||
gst-43 | NP_491070.1 | GST_N_Zeta | 4..77 | CDD:239340 | 28/80 (35%) |
maiA | 5..211 | CDD:273527 | 47/193 (24%) | ||
GST_C_Zeta | 90..207 | CDD:198300 | 17/100 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |