DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and gst-43

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:197 Identity:49/197 - (24%)
Similarity:83/197 - (42%) Gaps:26/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MSPPVLY-YLPPSPPCRSILLLAKMLDIDFELKIVNIL-EGEQLKPDFVAMNPQHCVPTMNDEGL 84
            |:.|:|| |...|...|..:.|| :.:||:|.:.:::. |..:...:||..||...|||:...||
 Worm     1 MAKPILYSYWRSSCAWRVRIALA-LKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGL 64

  Fly    85 VLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEG 149
            .|.||.||:.||       |:.||....:...:|:|.......|::..:......:.|...|:| 
 Worm    65 SLTESLAIIEYL-------DEAYPDPPFLPKELDKRSYSRAIALHIVASIQPLQAINIHKMLNE- 121

  Fly   150 KRAKLAEAVGWLNTIL-------------EGRQFSAADHFTIADLTLLVTVSQLEAFEFELRPYK 201
            |.....:.  |.|..:             ...::...|..||||:.|...:...:.::.::..|.
 Worm   122 KEPGYGDF--WCNHFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAKIYKVDMSKYP 184

  Fly   202 HI 203
            .|
 Worm   185 TI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 28/74 (38%)
GST_C_Delta_Epsilon 112..231 CDD:198287 17/105 (16%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 28/80 (35%)
maiA 5..211 CDD:273527 47/193 (24%)
GST_C_Zeta 90..207 CDD:198300 17/100 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.