DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and gst-36

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_509652.2 Gene:gst-36 / 187645 WormBaseID:WBGene00001784 Length:210 Species:Caenorhabditis elegans


Alignment Length:208 Identity:39/208 - (18%)
Similarity:73/208 - (35%) Gaps:41/208 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAI 92
            ||........:|.||..:.|..|:.:...:.:...||.:.    |...||.:..:|:.:.::.||
 Worm     7 YYFDVRGRGEAIRLLFHLADEKFDDERFGMEQWGVLKSEM----PLGQVPVLEIDGVKISQTTAI 67

  Fly    93 LSYLVAAYGKSDQLYPTDIRVRALVDQRLQFD------------LGTLYMRLTDYY----FPTMF 141
            ..||...:.::........|:..:.:...:|.            ||.:......::    .|.:.
 Worm    68 ARYLGHQFHRAGTNAVDCARLDMIAEVIQEFMSSSGMGKFSRVLLGMIQANKEQFFKENVLPDVE 132

  Fly   142 IGAP------LDEGKRAKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFELRPY 200
            ..||      |:.|.           |.:|.|.:.:..|.|.....:.|:.....:|    |..|
 Worm   133 KYAPIVEKFLLENGN-----------NGLLLGDRETWVDVFAAESFSKLIDYGSPDA----LDAY 182

  Fly   201 KHIRQWLDRCKDH 213
            .||...::|..:|
 Worm   183 PHILALINRVFNH 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 17/69 (25%)
GST_C_Delta_Epsilon 112..231 CDD:198287 22/124 (18%)
gst-36NP_509652.2 GST_N_Sigma_like 5..72 CDD:239337 16/68 (24%)
PTZ00057 6..208 CDD:173353 39/208 (19%)
GST_C_Sigma_like 83..192 CDD:198301 20/123 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.