DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and gst-15

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_496860.1 Gene:gst-15 / 185410 WormBaseID:WBGene00001763 Length:213 Species:Caenorhabditis elegans


Alignment Length:162 Identity:36/162 - (22%)
Similarity:72/162 - (44%) Gaps:32/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VPTMNDEGLVLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTM 140
            :|.:|.:|..:.:|.||..||...:|.:.:....:....|:|||...|.:.          |.|:
 Worm    55 LPVLNVDGFDIPQSAAICRYLAKKFGYAGKTPEEEAWADAVVDQFKDFSVA----------FKTL 109

  Fly   141 FI----GAPLDEGKRAKL-----AEAVGW--LNTILEGRQ--FSAADHFTIADLTL---LVTVSQ 189
            ..    |.|.:|..:.:.     |..|.:  ||.||:..:  :...|..|.|||.:   |.::.:
 Worm   110 LFATRAGKPEEEILKIRYEIFNPARDVYFILLNRILKKSKSGYLVGDGLTWADLVIADNLHSLEK 174

  Fly   190 LEAFEFELRPYKHIRQWLDR------CKDHMA 215
            |.|.:.:...:::::::.::      .:||:|
 Worm   175 LRAIDDDDEGHQNLKKYKEKIYGTPDLEDHIA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 8/21 (38%)
GST_C_Delta_Epsilon 112..231 CDD:198287 27/126 (21%)
gst-15NP_496860.1 GST_N_Sigma_like 4..77 CDD:239337 8/21 (38%)
PTZ00057 6..211 CDD:173353 36/162 (22%)
GST_C_Sigma_like 87..195 CDD:198301 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.