Sequence 1: | NP_001138040.1 | Gene: | GstD11 / 41512 | FlyBaseID: | FBgn0038029 | Length: | 243 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496859.1 | Gene: | gst-24 / 185407 | WormBaseID: | WBGene00001772 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 51/203 - (25%) |
---|---|---|---|
Similarity: | 78/203 - (38%) | Gaps: | 57/203 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 LYYLPP---SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQ---HCVPTMNDEGLV 85
Fly 86 LWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGK 150
Fly 151 RAKLAEAV----------------GWLNTILEGRQ--FSAADHFTIADLT---LLVTVSQLEAFE 194
Fly 195 FELRPYKH 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD11 | NP_001138040.1 | GST_N_Delta_Epsilon | 25..98 | CDD:239343 | 22/76 (29%) |
GST_C_Delta_Epsilon | 112..231 | CDD:198287 | 28/112 (25%) | ||
gst-24 | NP_496859.1 | GST_N_Sigma_like | 4..75 | CDD:239337 | 22/76 (29%) |
PTZ00057 | 6..208 | CDD:173353 | 51/203 (25%) | ||
GST_C_Sigma_like | 85..191 | CDD:198301 | 28/116 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |