Sequence 1: | NP_001138040.1 | Gene: | GstD11 / 41512 | FlyBaseID: | FBgn0038029 | Length: | 243 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509962.1 | Gene: | gst-42 / 183911 | WormBaseID: | WBGene00001790 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 56/201 - (27%) |
---|---|---|---|
Similarity: | 88/201 - (43%) | Gaps: | 38/201 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 PVLY-YLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWE 88
Fly 89 SRAILSYLVAAYGKSDQLYPTDIRVRA-------LVDQRLQ--FDLGTLYMRLTDYYFPTMFIGA 144
Fly 145 PLDE------GKRAK--LAEAVGWLNTILE--GRQFSAADHFTIADLTLLVTVSQLEAFEFELRP 199
Fly 200 YKHIRQ 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD11 | NP_001138040.1 | GST_N_Delta_Epsilon | 25..98 | CDD:239343 | 29/73 (40%) |
GST_C_Delta_Epsilon | 112..231 | CDD:198287 | 24/113 (21%) | ||
gst-42 | NP_509962.1 | GST_N_Zeta | 6..77 | CDD:239340 | 28/72 (39%) |
maiA | 7..211 | CDD:273527 | 55/200 (28%) | ||
GST_C_Zeta | 90..207 | CDD:198300 | 24/114 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |