DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and gst-42

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:201 Identity:56/201 - (27%)
Similarity:88/201 - (43%) Gaps:38/201 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PVLY-YLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWE 88
            |||| |...|...|..:.|| :.::|:|.|.|::| .|:.|.....:||...|||...:|.|:.|
 Worm     6 PVLYSYWRSSCSWRVRIALA-LKNVDYEYKTVDLL-SEEAKSKLKEINPAAKVPTFVVDGQVITE 68

  Fly    89 SRAILSYLVAAYGKSDQLYPTDIRVRA-------LVDQRLQ--FDLGTLYMRLTDYYFPTMFIGA 144
            |.||:.||...: ....|.|.|...||       ||...:|  .:|..|.:              
 Worm    69 SLAIIEYLEETH-PDVPLLPKDPIKRAHARAISLLVASGIQPLHNLKVLQL-------------- 118

  Fly   145 PLDE------GKRAK--LAEAVGWLNTILE--GRQFSAADHFTIADLTLLVTVSQLEAFEFELRP 199
             |::      |:.||  :.|.:..|..:|:  ..:::..|..|||||::...:.....|..:|.|
 Worm   119 -LNKKEAGFGGQFAKQFVVEGLTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSANRFNLDLSP 182

  Fly   200 YKHIRQ 205
            |..:.:
 Worm   183 YPTVNR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 29/73 (40%)
GST_C_Delta_Epsilon 112..231 CDD:198287 24/113 (21%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 28/72 (39%)
maiA 7..211 CDD:273527 55/200 (28%)
GST_C_Zeta 90..207 CDD:198300 24/114 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.