DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and gst-27

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:208 Identity:48/208 - (23%)
Similarity:77/208 - (37%) Gaps:56/208 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PCRSILLLAKMLDIDFELKIVNILEG--EQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLV 97
            |.|.:..||   |:.||...:.|.:|  |.||    |..|....|.::.:|..:.:|.||..||.
 Worm    17 PARILFHLA---DVPFEDFRMTIGDGTWENLK----AKTPFGQAPVLSVDGFEIPQSAAINRYLA 74

  Fly    98 AAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRAKLAEAVG--- 159
            ..:|.:.:.........|:|||            ..|:......:|.....||.   ||.||   
 Worm    75 KQFGYAGKTPEEQAWTDAIVDQ------------YKDFMVSIKEVGKASAAGKS---AEEVGKII 124

  Fly   160 -------------WLNTILEGRQ--FSAADHFTIADLTLLVTVSQLE--------------AFEF 195
                         .:|.|||..:  |...|..||||:.::..::.|:              |...
 Worm   125 QSDLVPARDAFFVIINKILEKSKSGFLVGDGLTIADIVIVECITTLDKHQLFTASEQPKLVALRE 189

  Fly   196 ELRPYKHIRQWLD 208
            ::.....|::|::
 Worm   190 KVYAIPAIKKWVE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 21/64 (33%)
GST_C_Delta_Epsilon 112..231 CDD:198287 26/129 (20%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 21/64 (33%)
PTZ00057 6..208 CDD:173353 48/208 (23%)
GST_C_Sigma_like 85..191 CDD:198301 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.