DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and Gstt2

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:221 Identity:62/221 - (28%)
Similarity:99/221 - (44%) Gaps:20/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWE-------SR 90
            |.|.|::.:.||...|.|:.:.|:||:|:.:...|..:|..:.||.:.|...||.|       |.
Mouse    11 SQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESPSSMIPST 75

  Fly    91 AILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDL----GTLYMRL-TDYYFPTMFIGAPLD--E 148
            |||.||.:.|..:|..||.|::.||.|.:.|.:..    ||..:.| |....|.:.:..|.:  |
Mouse    76 AILIYLSSKY
QVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPQEKVE 140

  Fly   149 GKRAKLAEAVGWL-NTILEGRQFSAADHFTIADLTLLVTVSQLEAFE---FELRPYKHIRQWLDR 209
            ..|.::...:..| :..|..|.|......|:|||..|..:.|..|..   ||.||  .:..|.:|
Mouse   141 RNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFEGRP--QLTAWRER 203

  Fly   210 CKDHMAPFDYEELNANKANMLADMFK 235
            .:..:.....:|.::...::|....|
Mouse   204 VEAFLGAELCQEAHSTILSILGQAAK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 25/71 (35%)
GST_C_Delta_Epsilon 112..231 CDD:198287 30/129 (23%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 25/73 (34%)
GST_C_Theta 98..223 CDD:198292 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.