DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and EEF1E1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_004271.1 Gene:EEF1E1 / 9521 HGNCID:3212 Length:174 Species:Homo sapiens


Alignment Length:169 Identity:46/169 - (27%)
Similarity:73/169 - (43%) Gaps:28/169 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTL-VDNGFALWESRAIQVYLVEKYGKTDSL 83
            |.|..:.|.:|.|.|..|.....:     .:..||.| .:||.:|.....|..:||::..| :.|
Human     2 AAAAELSLLEKSLGLSKGNKYSAQ-----GERQIPVLQTNNGPSLTGLTTIAAHLVKQANK-EYL 60

  Fly    84 YPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKK-IEAAFEFLNTFLEGQDY 147
            .....:::|::.|.|            .|...||      |..:.|. |....:.||::||.:.|
Human    61 LGSTAEEKAIVQQWL------------EYRVTQV------DGHSSKNDIHTLLKDLNSYLEDKVY 107

  Fly   148 AAGDSLTVADIALVATVSTF--EVAKFEISKYANVNRWY 184
            ..|.:.|:|||.|...:..|  ::...|..||.||:||:
Human   108 LTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/55 (27%)
GstA 4..185 CDD:223698 46/169 (27%)
GST_C_Delta_Epsilon 89..205 CDD:198287 28/99 (28%)
EEF1E1NP_004271.1 N-terminal 2..56 16/58 (28%)
Linker 57..63 2/6 (33%)
C-terminal 64..152 28/101 (28%)
GST_C_AIMP3 65..165 CDD:198338 28/100 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.