DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Clic5

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:188 Identity:46/188 - (24%)
Similarity:71/188 - (37%) Gaps:44/188 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VELNKK---LLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPK 86
            |:|.:|   |.||..|.|  |.||..           ||....:...|:.:|.|..  |...|||
  Rat    54 VDLKRKPADLHNLAPGTH--PPFLTF-----------NGDVKTDVNKIEEFLEETL--TPEKYPK 103

  Fly    87 CPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPAD-PEAFKKIEAAFEFLNTFL-------- 142
            ...:....| ....|:.:.:.::......|..|..... .:|.:|::   ::|||.|        
  Rat   104 LAARHRESN-TAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKLD---DYLNTPLPEEIDTNT 164

  Fly   143 EGQD------YAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGW 194
            .|.:      :..||.||:||..|:..:   .|.|....||.|    |:...::|..|
  Rat   165 HGDEKGSQRKFLDGDELTLADCNLLPKL---HVVKIVAKKYRN----YDIPAEMTGLW 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/52 (29%)
GstA 4..185 CDD:223698 43/177 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 26/121 (21%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 16/58 (28%)
O-ClC 14..249 CDD:129941 46/188 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.