DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and CLIC3

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:174 Identity:38/174 - (21%)
Similarity:69/174 - (39%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GSSP-CRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLK-INPQHTIPTLVDNGFALWESRAIQV 71
            |..| |:.:.|.....||......::.:.    .|:.|| ..|...:|.|:.:..|..::..|:.
Human    20 GHCPSCQRLFMVLLLKGVPFTLTTVDTRR----SPDVLKDFAPGSQLPILLYDSDAKTDTLQIED 80

  Fly    72 YLVEKYGKTD--SLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEA-FKKIEA 133
            :|.|..|..|  ||.|:..:.....|.        ::..|:.:....|    ||..|| ::::..
Human    81 FLEETLGPPDFPSLAPRYRESNTAGND--------VFHKFSAFIKNPV----PAQDEALYQQLLR 133

  Fly   134 AFEFLNTFLEG----------------QDYAAGDSLTVADIALV 161
            |...|:::|..                :.:..||.||:||.:|:
Human   134 ALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/67 (22%)
GstA 4..185 CDD:223698 38/174 (22%)
GST_C_Delta_Epsilon 89..205 CDD:198287 17/90 (19%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 16/71 (23%)
PLN02817 5..229 CDD:330276 38/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.