DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and URE2

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:51/220 - (23%)
Similarity:82/220 - (37%) Gaps:62/220 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNG---FALWESRAIQVYLVEKY 77
            |.:....:|...|...|:...|||..|||:.:||...:|.|:|:|   .::|||.||.::||.||
Yeast   128 VAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWESGAILLHLVNKY 192

  Fly    78 GKTDS------------------LYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKA--- 121
            .|...                  |:.:......:|.|.|:|          .|::.|..|.|   
Yeast   193 YKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHF----------RYFHSQKIASAVER 247

  Fly   122 ----------PADPEAFKKIEAAFEFLNT-----------------FLEGQDYAAGDSLTVADIA 159
                      ..:....::.||....|:|                 |.:...:..||.||:||:|
Yeast   248 YTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIADLA 312

  Fly   160 LVATVSTFEVAKFEIS-KYANVNRW 183
            .|...:..:.....|. ::..|.:|
Yeast   313 FVPWNNVVDRIGINIKIEFPEVYKW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/61 (36%)
GstA 4..185 CDD:223698 51/220 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/126 (19%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 25/65 (38%)
GST_C_Ure2p 208..350 CDD:198326 25/140 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2827
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.