DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GTT1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:47/207 - (22%)
Similarity:76/207 - (36%) Gaps:42/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LNLQ---------AGEHLKPEFLKINPQHTIPTL------VDNGFALWESRAIQVYLVEKYGKTD 81
            |||:         |.....||..||:|....|.|      ......|.||..|..|:::.:..:.
Yeast    26 LNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSH 90

  Fly    82 SLYPKCPKKRAVINQRLYFDMGTLYQSF-----------ANYYYP-QVFAKAPAD--PEAFKKIE 132
            .|..:.......||..|::..|:|....           :...:| ...|:..||  .:|:...|
Yeast    91 VLMSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARKVADKISQAYSSGE 155

  Fly   133 AAFEFLNTFLEGQ-----DYAAGDSLTVADIALVATVSTFEVAKFEISK-YANVNRWYENAKKVT 191
            ...:|  .|:||:     .|.....|:.|||.:...:......||...: |..:::|   .|.:|
Yeast   156 VKNQF--DFVEGEISKNNGYLVDGKLSGADILMSFPLQMAFERKFAAPEDYPAISKW---LKTIT 215

  Fly   192 PGWEENWAGCLE 203
            .  ||::|...|
Yeast   216 S--EESYAASKE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 16/57 (28%)
GstA 4..185 CDD:223698 41/187 (22%)
GST_C_Delta_Epsilon 89..205 CDD:198287 30/135 (22%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 16/60 (27%)
GST_C_GTT1_like 93..218 CDD:198298 26/131 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.