DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and TEF4

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:40/186 - (21%)
Similarity:75/186 - (40%) Gaps:33/186 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ELNKKLLNLQAGEHLKPEFLKINPQHTIPT-LVDNGFALWESRAIQVYLVEKYGKTDSLYPKCPK 89
            :|:.|:::|:...    ||..:.|....|. |...|..|.|:.|||.||..:...        .|
Yeast    25 KLDVKIVDLEQSS----EFASLFPLKQAPAFLGPKGLKLTEALAIQFYLANQVAD--------EK 77

  Fly    90 KRA------VINQRLYFDMGTLYQS--FANYYYPQVFAKA-----PADPEA-FKKIEAAFEFLNT 140
            :||      ||.:.......:|..|  .:|...|.:..|.     ..|.:| |.||:......:.
Yeast    78 ERARLLGSDVIEKSQILRWASLANSDVMSNIARPFLSFKGLIPYNKKDVDACFVKIDNLAAVFDA 142

  Fly   141 FLEGQDYAAGDSLTVADIALVAT----VSTFEVAKFEISKYANVNRWYENAKKVTP 192
            .|....:.|.:::::.|:....:    ::|....::. :|:.::.||: |....:|
Yeast   143 RLRDYTFVATENISLGDLHAAGSWAFGLATILGPEWR-AKHPHLMRWF-NTVAASP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 16/49 (33%)
GstA 4..185 CDD:223698 38/177 (21%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/122 (20%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 16/50 (32%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 19/110 (17%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.