DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and YGR201C

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:49/195 - (25%)
Similarity:79/195 - (40%) Gaps:27/195 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RSVIMTAKAVGVELNKKLLNLQAGEHL-KPEFLKINPQHTIPTLV--DNGFALWESRAIQVYLV- 74
            |:::.......::|:.||.:....:.| :.||    |....||.|  .:.:.|.|:.||..||: 
Yeast    17 RTIVPRGLVRSLKLDVKLADPSDAQQLYEREF----PLRKYPTFVGPHDEWTLTEAMAIDYYLIH 77

  Fly    75 ---EKYGKTDSLYPKCP-KKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAF 135
               :|......|.|:.. |.||.|.:................::|.:..| |.:...||   ||.
Yeast    78 LSSDKEAVRQLLGPEGDFKTRADILRWESLSNSDFLNEVCEVFFPLIGVK-PYNATEFK---AAR 138

  Fly   136 EFLNTF-------LEGQDY-AAGDSLTVADIALVATVSTFEVAKFE---ISKYANVNRWYENAKK 189
            |.::|.       |:.|.| ...|..|:||:...|..|...::.|:   .||:..|.||:....|
Yeast   139 ENVDTIVSLYEKRLKKQQYLVCDDHETLADLISAAAFSLGFISFFDETWRSKHPEVTRWFNRVIK 203

  Fly   190  189
            Yeast   204  203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 17/67 (25%)
GstA 4..185 CDD:223698 48/189 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 29/112 (26%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 17/64 (27%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.