DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and AT1G66235

DIOPT Version :10

Sequence 1:NP_524326.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_683473.2 Gene:AT1G66235 / 842939 AraportID:AT1G66235 Length:284 Species:Arabidopsis thaliana


Alignment Length:42 Identity:12/42 - (28%)
Similarity:16/42 - (38%) Gaps:9/42 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GSSPCRSVIMTAKAVGVELNKKLL---------NLQAGEHLK 41
            |.||.:..|...|:.....|.::|         |.|..|.||
plant   174 GRSPYQRPIRVKKSKLKRKNDQILDVIKTFEEGNKQLMEQLK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_524326.1 GST_N_Delta_Epsilon 2..75 CDD:239343 12/42 (29%)
GST_C_Delta_Epsilon 89..205 CDD:198287
AT1G66235NP_683473.2 NAM-associated 114..266 CDD:464129 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.