DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and clic3

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:218 Identity:47/218 - (21%)
Similarity:85/218 - (38%) Gaps:63/218 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GSSP-CRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLK-INPQHTIPTLVDNGFALWESRAIQV 71
            |:.| |:.:.|.....||......::::..    ||.|| :.|....|.|:.||....::..|:.
Zfish    21 GNCPFCQRLFMILWLKGVNFTLTTVDMKRA----PEVLKDLAPGSQPPFLIYNGEVRTDTNKIEE 81

  Fly    72 YLVEKYGKTDSL----YPK-CPKKRAVINQRLYFDMGT----LYQSFANYYYPQVFAKAPADPEA 127
            :|      .|:|    ||| |.:         |.:..|    ::..|:.|      .|.| :|..
Zfish    82 FL------EDTLAPPQYPKLCCR---------YKESNTAGDDIFHKFSAY------IKNP-NPGL 124

  Fly   128 FKKIEAAF--------EFLNTFL------------EGQDYAAGDSLTVADIALVATVSTFEVA-- 170
            ...:|..|        ::|.|.|            ..:.|..|::|::||..|:..:...:|.  
Zfish   125 NDMLEKKFLKSLMKLDQYLLTPLPHELDQNPELSTSTRHYLDGNALSLADCNLLPKLHIVKVVCK 189

  Fly   171 ---KFEI-SKYANVNRWYENAKK 189
               .||| ::...::::.:.|.|
Zfish   190 KYRGFEIPAELKGLSKYLDKAYK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 17/67 (25%)
GstA 4..185 CDD:223698 45/212 (21%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/131 (18%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 19/80 (24%)
O-ClC 6..237 CDD:129941 47/218 (22%)
GST_C_CLIC3 99..231 CDD:198332 24/121 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.