DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GSTF5

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:218 Identity:54/218 - (24%)
Similarity:86/218 - (39%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAI 69
            |..|.|:..|.|:......|:..:...:||.||:..||.||.|||...:|..:|.|..|.|||||
plant    67 YGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRAI 131

  Fly    70 QVYLVEKYGKTDSLYPKCPKKRA--VINQRLYFDMG--------------------TLYQSFANY 112
            ..|:...:           |.|.  ::|.:.|..||                    |..||....
plant   132 SEYIATVH-----------KSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPM 185

  Fly   113 YYPQVFAKAPADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTF---EVAKFEI 174
            |..:...|...:.||  |:|...:.....|:...:.|.:|.|:||:..:..:...   ...:..:
plant   186 YGLKTDYKVVNETEA--KLEKVLDIYEERLKNSSFLASNSFTMADLYHLPNIQYLMDTHTKRMFV 248

  Fly   175 SKYANVNRWYENAKKVT--PGWE 195
            :: .:|.||   ..::|  |.|:
plant   249 NR-PSVRRW---VAEITARPAWK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 27/69 (39%)
GstA 4..185 CDD:223698 51/204 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 27/134 (20%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 27/68 (40%)
GST_C_Phi 153..270 CDD:198296 23/121 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.