DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GSTF4

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:213 Identity:55/213 - (25%)
Similarity:84/213 - (39%) Gaps:44/213 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TAKAVGVELNKKL------LNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKY 77
            |.:.:.|...|:|      :.||.|||....||.:||...:|...|....|:|||||..|:.   
plant    48 TRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQYIA--- 109

  Fly    78 GKTDSLYPKCPKKRAVINQRLYFDMGTL---YQSFANYYYP--------QVFAK---APADPEAF 128
                  |....:...::|.|.:..|.||   .:..|:.:.|        ||...   ...|....
plant   110 ------YVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKPIYGLETDQTIV 168

  Fly   129 KKIEAAFE-FLNTF---LEGQDYAAGDSLTVADIALVATV----STFEVAKFEISKYANVNRWYE 185
            |:.||..| .||.:   ||...:.|.:|.|:.|:..:..:    .|.....||  |.:.|.:|.:
plant   169 KENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGTPTKKLFE--KRSKVRKWVD 231

  Fly   186 -----NAKKVTPGWEENW 198
                 .|.|:....|::|
plant   232 EITSREAWKMACDQEKSW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/61 (36%)
GstA 4..185 CDD:223698 51/193 (26%)
GST_C_Delta_Epsilon 89..205 CDD:198287 32/137 (23%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 22/60 (37%)
GST_C_Phi 126..243 CDD:198296 28/118 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.