DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GSTF12

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:218 Identity:54/218 - (24%)
Similarity:93/218 - (42%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDFYYLPGSSPC-RSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALW 64
            ||...|...::.| :.|::.....|:|.....::|...|..|||.|...|...:|.:.|..|.|:
plant     1 MVVKLYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLF 65

  Fly    65 ESRAIQVYLVEKYG-KTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYY-------------- 114
            |||||..|...|:. :..:|..|..:.||:::|  :.|:.|       ||:              
plant    66 ESRAIARYYATKFADQGTNLLGKSLEHRAIVDQ--WADVET-------YYFNVLAQPLVINLIIK 121

  Fly   115 PQVFAKAPAD-PEAFK-KIEAAFEFLNTFLEGQDYAAGDSLTVADI----ALVATVSTFEVAKFE 173
            |::..|.... .|..| |:....:..|..|....:.||:..|:||:    |:...:|..::.:. 
plant   122 PRLGEKCDVVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQM- 185

  Fly   174 ISKYANVNRWYENAKKVTPGWEE 196
            :....:.|||:|.... .|.|::
plant   186 VKARGSFNRWWEEISD-RPSWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 23/73 (32%)
GstA 4..185 CDD:223698 49/202 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 27/128 (21%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 54/218 (25%)
GST_N_Phi 2..77 CDD:239351 23/74 (31%)
GST_C_Phi 91..209 CDD:198296 27/128 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.