DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:187 Identity:53/187 - (28%)
Similarity:88/187 - (47%) Gaps:33/187 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGK--TDSLYPKCPKKRAVI 94
            :||.|..|..|.||.:||...:|.|.|:...|:|||||..|:.||:..  ||....:.||:.|::
plant    33 VNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRAITAYIAEKHRDKGTDLTRHEDPKEAAIV 97

  Fly    95 NQRLYFDMGTLYQSFANYYYPQVFA------------KAPADPEAFKKIEAAFEFLNTFLE--GQ 145
              :|:.::.      |:::.|.:.|            ::|......:.:|...:.|:.:.|  |:
plant    98 --KLWSEVE------AHHFNPAISAVIHQLIVVPLQGESPNAAIVEENLENLGKILDVYEERLGK 154

  Fly   146 -DYAAGDSLTVADIALVATVSTF--EVAKFEISKYANVNRWYENA------KKVTPG 193
             .|.|||:.|:||:..|.....|  .:....|:...||..|:|:.      .||:||
plant   155 TKYLAGDTYTLADLHHVPYTYYFMKTIHAGLINDRPNVKAWWEDLCSRPAFLKVSPG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 19/42 (45%)
GstA 4..185 CDD:223698 48/171 (28%)
GST_C_Delta_Epsilon 89..205 CDD:198287 29/128 (23%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 50/183 (27%)
GST_N_Phi 2..77 CDD:239351 19/43 (44%)
GST_C_Phi 92..208 CDD:198296 25/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.