DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GSTF11

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:206 Identity:52/206 - (25%)
Similarity:84/206 - (40%) Gaps:57/206 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGK--TDSL 83
            :.:.|:|:|.       |..||:.|...|...:|.:.|....|:|||||..|...||..  || |
plant    29 EVIHVDLDKL-------EQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYADQGTD-L 85

  Fly    84 YPKCPKKRAVINQRLYFDMGTLYQSFANYYY----PQVF-------AKAPADPEAFKKIEAAFE- 136
            ..|..:.||:::|.:..:        .||:|    |.|.       :..|.|....::::..|: 
plant    86 LGKTLEGRAIVDQWVEVE--------NNYFYAVALPLVMNVVFKPKSGKPCDVALVEELKVKFDK 142

  Fly   137 FLNTF---LEGQDYAAGDSLTVADI-------------ALVATVSTFEVAKFEISKYANVNRWYE 185
            .|:.:   |....|..||..|:||:             :|...|::.|          |:|||: 
plant   143 VLDVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGLVTSRE----------NLNRWW- 196

  Fly   186 NAKKVTPGWEE 196
            |.....|.|::
plant   197 NEISARPAWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 17/53 (32%)
GstA 4..185 CDD:223698 49/193 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 29/136 (21%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 52/206 (25%)
GST_N_Phi 2..77 CDD:239351 17/54 (31%)
GST_C_Phi 91..209 CDD:198296 29/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.