DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GSTF10

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:219 Identity:60/219 - (27%)
Similarity:95/219 - (43%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWE 65
            ||...|.|..:..:..::|....||......::|..||..:||:|.|.|...||.|||..:.::|
plant     1 MVLTIYAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFE 65

  Fly    66 SRAIQVYLVEKY-GKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKA-------- 121
            ||||..|:.||| .:...|..|..::|..:.|.|..:        |..|:|.:.|..        
plant    66 SRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVE--------ATSYHPPLLALTLNIVFAPL 122

  Fly   122 ---PADPEAFKKIEAAF-EFLNTF---LEGQDYAAGDSLTVADIA-------LVATVSTFEVAKF 172
               |||.:..|:.|... |.|:.:   |...:|.|||.:::||:|       ||..:....:   
plant   123 MGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHL--- 184

  Fly   173 EISKYANVNRWYENAKKVTPGWEE 196
             |....:|:.|::.... ...|:|
plant   185 -IKDRKHVSAWWDKISS-RAAWKE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 25/72 (35%)
GstA 4..185 CDD:223698 56/203 (28%)
GST_C_Delta_Epsilon 89..205 CDD:198287 29/130 (22%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 60/219 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.