DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GSTF3

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:202 Identity:50/202 - (24%)
Similarity:77/202 - (38%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVY 72
            |.|:..|.|::......::.....:.|:.|||.|..||..||...:|...|....|:|||||..|
plant    10 PASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQY 74

  Fly    73 LVEKY-GKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYP--------QVF---------A 119
            :..:| .:..:|.|...|     |...|..|....|..|:.:.|        |||         .
plant    75 IAHRYENQGTNLLPADSK-----NIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNTDQ 134

  Fly   120 KAPADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTF--EVAKFEISKYANVNR 182
            ...|:.||  |:....:.....|:...|.||::.|:.|:..:..:...  ...|...::...||.
plant   135 AVVAEEEA--KLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKKLFTERPRVNE 197

  Fly   183 WYENAKK 189
            |.....|
plant   198 WVAEITK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/66 (33%)
GstA 4..185 CDD:223698 49/196 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 25/120 (21%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 50/202 (25%)
GST_N_Phi 4..78 CDD:239351 22/67 (33%)
GST_C_Phi 96..212 CDD:198296 23/111 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.