DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and gdap1l1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001072239.1 Gene:gdap1l1 / 779687 XenbaseID:XB-GENE-950543 Length:364 Species:Xenopus tropicalis


Alignment Length:268 Identity:46/268 - (17%)
Similarity:88/268 - (32%) Gaps:102/268 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTL------------- 56
            |:...|...:.:.:.....|...:::.::|...||.:|.|:::|....:|.:             
 Frog    48 YHWTQSFSSQKIRLVIAEKGFPCDERDVSLPLTEHKEPWFMRLNLGEEVPVVIHGDNIISDYNQI 112

  Fly    57 ---VDNGF-------------ALWESRAIQV-YLVEK-------YG-------KTDSLYPKCPKK 90
               ::|.|             .::.||.:|. .:::|       :|       .|||:.|    |
 Frog   113 IDYIENNFVGELIPKLIPETETIFHSRVLQYREILDKLPMDAYTHGCILHPELTTDSMIP----K 173

  Fly    91 RAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFK-------------------------- 129
            .|....|.:....:...:..::..||:.     :|...|                          
 Frog   174 YATAEIRRHLANASTELTKLDHEEPQLM-----EPYLSKQKKLMAKILEHDNVNYLTKILIQLSM 233

  Fly   130 ---KIEAAFEFLNTFLEGQD---YAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAK 188
               :|||..|......|||.   :..|...|:||:.|.||:...        |:..:::.|    
 Frog   234 VLDQIEAELEKRKLEYEGQKCELWLCGHIFTLADVLLGATLHRL--------KFLGLSKKY---- 286

  Fly   189 KVTPGWEE 196
                 ||:
 Frog   287 -----WED 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/99 (15%)
GstA 4..185 CDD:223698 43/255 (17%)
GST_C_Delta_Epsilon 89..205 CDD:198287 25/140 (18%)
gdap1l1NP_001072239.1 Thioredoxin_like 45..117 CDD:381987 10/68 (15%)
GST_C_family 198..308 CDD:383119 22/114 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.