DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Gsto2

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:176 Identity:40/176 - (22%)
Similarity:66/176 - (37%) Gaps:55/176 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPE-FLKINPQHTIPTLVDNGFAL-WESRA 68
            :.|.|...|.|:   ||.|:......:||::    ||: :...:|...||.|.::...| :||..
Mouse    31 FCPYSHRARLVL---KAKGIRHEVININLKS----KPDWYYTKHPFGQIPVLENSQCQLVYESVI 88

  Fly    69 IQVYLVEKY-GKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAP---------- 122
            ...||.:.| |:  .|:|..|.:||  .|::..::               |.|.|          
Mouse    89 ACEYLDDVYPGR--KLFPYDPYERA--RQKMLLEL---------------FCKVPPLSKECLIAL 134

  Fly   123 -----------ADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVAD 157
                       |..:....:|...|:.||...|     ||.:::.|
Mouse   135 RCGRDCTDLKVALRQELCNMEEILEYQNTTFFG-----GDCISMID 175

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 20/70 (29%)
GstA 4..185 CDD:223698 40/176 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 15/90 (17%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 19/69 (28%)