DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and gstr

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:208 Identity:50/208 - (24%)
Similarity:88/208 - (42%) Gaps:16/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNK-KLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRA 68
            |:..||.||..:::..:...::..| |||:....||..||...:||:..:||.......:.||.|
Zfish     8 YWGTGSPPCWRLMIALEEKQLQGYKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGEIVVNESFA 72

  Fly    69 IQVYLVEKYGKTDS--LYPKCPKKRAVINQRLYFDMGTLYQ-----SFANYYYPQVFAKAPADPE 126
            ..:|| |...|:..  |.|..|.:.|::.||: |:...|.|     :|.::..|:......|...
Zfish    73 ACLYL-ESVFKSQGTRLIPDNPAEMALVYQRM-FETENLQQKMYEVAFYDWLVPEGERLESALKR 135

  Fly   127 AFKKIEAAFEFLNTFLEGQ---DYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAK 188
            ..:|:....:....:||..   .|.||.:.::||:.....::.|...:....:...:..:||..|
Zfish   136 NKEKLIEELKLWEGYLEKMGKGSYLAGKNFSMADVVCFPVIAYFPRLQCPKERCPRLMEYYEMVK 200

  Fly   189 ---KVTPGWEENW 198
               .:...|...|
Zfish   201 DRPSIKASWPPEW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/70 (31%)
GstA 4..185 CDD:223698 45/190 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 23/121 (19%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 48/200 (24%)
GST_N_family 5..78 CDD:238319 22/70 (31%)
GST_C_family 99..199 CDD:198286 19/100 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.