DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and gdap1l1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:275 Identity:45/275 - (16%)
Similarity:89/275 - (32%) Gaps:92/275 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAI 69
            |:...|...:.|.:.....|:...::.::|...|..:|.|:::|....:|..:.....:.:...|
Zfish    51 YHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSDYNQI 115

  Fly    70 QVYL-----------------------VEKYGK---------------------TDSLYPK---C 87
            ..|:                       |::|.:                     |||:.||   .
Zfish   116 IDYIETNFVGDTVAQLIPDEGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTTDSMIPKYATA 180

  Fly    88 PKKRAVIN-----QRLYFDMGTLYQSFAN---------------YYYPQVFAKAPADPEAFKKIE 132
            ..:|.:.|     .:|..:...|.:.:.:               .|..::..:...   ...::|
Zfish   181 EIRRHLANAASELMKLDHEEPQLTEPYLSKQKKLMAKILDHDNVNYLKKILGELAM---VLDQVE 242

  Fly   133 AAFEFLNTFLEGQD---YAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGW 194
            |..|......:||.   :..|.:.|:|||.|.||:...        |:..::|.|         |
Zfish   243 AELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRL--------KFLGLSRKY---------W 290

  Fly   195 EENWAGCLEFKKYFE 209
            |:.....|:  .:||
Zfish   291 EDGSRPNLQ--SFFE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 12/92 (13%)
GstA 4..185 CDD:223698 39/249 (16%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/138 (17%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 45/275 (16%)
Thioredoxin_like 48..120 CDD:294274 12/68 (18%)
GST_C_GDAP1L1 201..311 CDD:198335 23/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.