DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and gdap1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:257 Identity:47/257 - (18%)
Similarity:83/257 - (32%) Gaps:94/257 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAI 69
            |:...|...:.|.:.....|::.....::|...||.:|.|:::||...:|.||.:...:.:...|
Zfish    43 YHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVICDPTQI 107

  Fly    70 QVYLVEKY------------GKT------------DS-----------LYPKCP----------- 88
            ..||.:.:            |.|            ||           |:|:..           
Zfish   108 MDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYRELLDSLQMDAYTHGCILHPEITVDSHIPAYATT 172

  Fly    89 -------------KKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNT 140
                         ||.||.|.    |:...|.:.......::|     |.:..|.::...:.|..
Zfish   173 HIRTQIGNTESELKKLAVENP----DLKDAYIAKQRRLKSKLF-----DHDNMKYLKKLLDELEN 228

  Fly   141 FL----------------EG--QDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWY 184
            .|                ||  |.:..||..::||::|..|:...        |:..::|.|
Zfish   229 VLDQVETELQRRSEETPEEGSQQAWLCGDFFSIADVSLAVTLHRL--------KFLGLSRRY 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 17/69 (25%)
GstA 4..185 CDD:223698 47/257 (18%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/114 (21%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 47/257 (18%)
GST_N_GDAP1 40..112 CDD:239350 16/68 (24%)
GST_C_family 193..304 CDD:295467 19/107 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.