DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Hpgds

DIOPT Version :10

Sequence 1:NP_524326.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001398181.1 Gene:Hpgds / 54486 MGIID:1859384 Length:200 Species:Mus musculus


Alignment Length:117 Identity:29/117 - (24%)
Similarity:42/117 - (35%) Gaps:46/117 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEK---YGKTD-----------------SLY 84
            :||..    |...||.|...|..:.:|.||..||.:.   .|||.                 ||:
Mouse    42 IKPTL----PFGKIPVLEVEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLF 102

  Fly    85 PKCPK----KRAVINQ-------RLYFDMGTL----------YQ-SFANYYY 114
            |...|    |..:.|:       ||..|:.|.          || ::|::|:
Mouse   103 PWAEKDQDLKERMFNELLTHQAPRLLKDLDTYLGDKEWFIGNYQVTWADFYW 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_524326.1 GST_N_Delta_Epsilon 2..75 CDD:239343 12/34 (35%)
GST_C_Delta_Epsilon 89..205 CDD:198287 11/48 (23%)
HpgdsNP_001398181.1 GST_N_Sigma_like 4..73 CDD:239337 12/34 (35%)
GST_C_Sigma 83..182 CDD:198328 14/72 (19%)

Return to query results.
Submit another query.