DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Gstt3

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:161 Identity:46/161 - (28%)
Similarity:77/161 - (47%) Gaps:9/161 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLV 74
            |.|||:|.:.||..|:....:.:.|..|:|....|.::||...:|.|.|..|.|.||.||.:||.
  Rat    68 SQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVLAESVAILLYLS 132

  Fly    75 EKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQ----VFAKAPADPE----AFKKI 131
            .||...|..||:..:.||.:::.|.:....|....:...:.:    ||...|..||    ...::
  Rat   133 RKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVFLGQPVPPERLASTLAEL 197

  Fly   132 EAAFEFL-NTFLEGQDYAAGDSLTVADIALV 161
            :...:.| :.||:.:.:..|..::|||:..:
  Rat   198 DGCLQMLEDKFLQNKAFLTGPHISVADLVAI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 25/64 (39%)
GstA 4..185 CDD:223698 46/161 (29%)
GST_C_Delta_Epsilon 89..205 CDD:198287 16/82 (20%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 25/66 (38%)
GST_C_Theta 149..273 CDD:198292 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348112
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.650

Return to query results.
Submit another query.