DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Gsta5

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001010921.1 Gene:Gsta5 / 494499 RGDID:1593189 Length:222 Species:Rattus norvegicus


Alignment Length:221 Identity:57/221 - (25%)
Similarity:87/221 - (39%) Gaps:43/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQ---HTIPTLVDNGFA 62
            ::.::...|...|...::.  |.|||..:||  :|:.|.|  |.||.:..   ..:|.:..:|..
  Rat     6 VLHYFNARGRMECIRWLLA--AAGVEFEEKL--IQSPEDL--EKLKKDGNLMFDQVPMVEIDGMK 64

  Fly    63 LWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEA 127
            |.::|||..|:..||    .||.|..|:||:|:.   :..|.|  .........|.  .|.|...
  Rat    65 LAQTRAILNYIATKY----DLYGKDMKERALIDM---YSEGIL--DLTEMIIQLVI--CPPDQRE 118

  Fly   128 FKKIEAAFEFLNTFL---------EGQDYAAGDSLTVADI---ALVATVSTFEVA---------- 170
            .|...|.....|.:|         .||||..|:.||..||   .|:..|..|:.:          
  Rat   119 AKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTPFPLLKA 183

  Fly   171 -KFEISKYANVNRWYENAKKVTPGWE 195
             |..||...||.::.:...:..|..:
  Rat   184 FKSRISSLPNVKKFLQPGSQRKPAMD 209

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 21/75 (28%)
GstA 4..185 CDD:223698 56/206 (27%)
GST_C_Delta_Epsilon 89..205 CDD:198287 31/130 (24%)
Gsta5NP_001010921.1 PTZ00057 1..208 CDD:173353 57/218 (26%)
GST_N_Alpha 4..82 CDD:239375 23/85 (27%)