Sequence 1: | NP_001034042.1 | Gene: | GstD1 / 41503 | FlyBaseID: | FBgn0001149 | Length: | 209 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007386.1 | Gene: | clic5a / 492513 | ZFINID: | ZDB-GENE-041114-84 | Length: | 246 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 50/201 - (24%) |
---|---|---|---|
Similarity: | 73/201 - (36%) | Gaps: | 62/201 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 GVELNKKLLNLQAGEHLKPEFL-KINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPKC 87
Fly 88 PKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPA-----DPEA-----------FKKIEAAFE 136
Fly 137 FLNTFL--------------EGQDYAAGDSLTVADIALVATVSTFEVA-----KFEI-SKYANVN 181
Fly 182 RWYENA 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD1 | NP_001034042.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 14/51 (27%) |
GstA | 4..185 | CDD:223698 | 48/197 (24%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 32/135 (24%) | ||
clic5a | NP_001007386.1 | GST_N_CLIC | 8..97 | CDD:239359 | 16/63 (25%) |
O-ClC | 10..244 | CDD:129941 | 50/201 (25%) | ||
GST_C_CLIC5 | 104..244 | CDD:198330 | 30/130 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589644 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |