DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstD5

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:208 Identity:142/208 - (68%)
Similarity:169/208 - (81%) Gaps:0/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWES 66
            :||||.|..|.||:|||.|||:||:||.||||....:.|||||:|:||||||||||||||::|||
  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly    67 RAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKI 131
            |||.|||||||||.|:|:||.|||:|::||||||||||||.|||.||||......|...|.||||
  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKKI 130

  Fly   132 EAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWEE 196
            |::||:||.|||||:|.|||.|||||||:::||||||:..|:::||.||.|||.|||||||||||
  Fly   131 ESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVARWYANAKKVTPGWEE 195

  Fly   197 NWAGCLEFKKYFE 209
            ||.|.:|.|..|:
  Fly   196 NWKGAVELKGVFD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 51/72 (71%)
GstA 4..185 CDD:223698 123/180 (68%)
GST_C_Delta_Epsilon 89..205 CDD:198287 78/115 (68%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 124/182 (68%)
GST_N_Delta_Epsilon 1..74 CDD:239343 51/72 (71%)
GST_C_Delta_Epsilon 88..204 CDD:198287 78/115 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468471
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.