DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and gstt1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 / 448525 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis


Alignment Length:174 Identity:54/174 - (31%)
Similarity:84/174 - (48%) Gaps:21/174 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLV 74
            |.|||||.:.|||..:..|...:.|..||||..|:.|:|....:|.|.|..|.:.||.|:.:|:.
 Frog    12 SQPCRSVYIFAKANNIPFNNHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDFFMAESTAMLLYMA 76

  Fly    75 EKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYY-----PQVFA-KAPADPEAFKKIEA 133
            .|:...|..||...:|.|.:::.|.:.......:.:..::     |.:.. :|||:     |::|
 Frog    77 RKFKTADHWYPSDIQKCAKVDEYLAWQHTNTRPNGSKVFWVKCLTPLILGQEAPAE-----KVDA 136

  Fly   134 AFEFLNT--------FLEGQDYAAGDSLTVADIALVATVSTFEV 169
            .....||        ||..:.:.|||.::|||  |||.|...:|
 Frog   137 VVAEFNTTMNNFEEKFLGNKLFIAGDEISVAD--LVAIVEIMQV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 26/64 (41%)
GstA 4..185 CDD:223698 54/174 (31%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/95 (25%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 26/66 (39%)
GST_C_Theta 92..217 CDD:198292 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.