DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and gsto1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:213 Identity:50/213 - (23%)
Similarity:83/213 - (38%) Gaps:66/213 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VIMTAKAVGVELNKKLLNLQAGEHLKPE-FLKINPQHTIPTL-VDNGFALWESRAIQVYLVEKYG 78
            :::.||  |::.:...:||:.    ||: ||:.||...:|.| ..:|..::||.....||.|.|.
Zfish    39 LVLNAK--GIKYDTININLKN----KPDWFLEKNPLGLVPVLETQSGQVIYESPITCEYLDEVYP 97

  Fly    79 KTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNTFLE 143
            : ..|.|..|.:||  .||:..:   |:.....|:|     |.|.:....:.:.|    |.|.|:
Zfish    98 E-KKLLPFDPFERA--QQRMLLE---LFSKVTPYFY-----KIPVNRTKGEDVSA----LETELK 147

  Fly   144 GQ-------------DYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWE 195
            .:             .:..|||:|:.|..:..                    |:|..:.:     
Zfish   148 DKLSQFNEILLKKKSKFFGGDSITMIDYMMWP--------------------WFERLETM----- 187

  Fly   196 ENWAGCL----EFKKYFE 209
             |...||    |.||:.|
Zfish   188 -NLKHCLDGTPELKKWTE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 18/60 (30%)
GstA 4..185 CDD:223698 42/183 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/132 (18%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 17/59 (29%)
GstA 25..210 CDD:223698 50/213 (23%)
GST_C_Omega 107..229 CDD:198293 27/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.