Sequence 1: | NP_001034042.1 | Gene: | GstD1 / 41503 | FlyBaseID: | FBgn0001149 | Length: | 209 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002621.1 | Gene: | gsto1 / 436894 | ZFINID: | ZDB-GENE-040718-365 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 213 | Identity: | 50/213 - (23%) |
---|---|---|---|
Similarity: | 83/213 - (38%) | Gaps: | 66/213 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 VIMTAKAVGVELNKKLLNLQAGEHLKPE-FLKINPQHTIPTL-VDNGFALWESRAIQVYLVEKYG 78
Fly 79 KTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNTFLE 143
Fly 144 GQ-------------DYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWE 195
Fly 196 ENWAGCL----EFKKYFE 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD1 | NP_001034042.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 18/60 (30%) |
GstA | 4..185 | CDD:223698 | 42/183 (23%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 24/132 (18%) | ||
gsto1 | NP_001002621.1 | GST_N_Omega | 4..93 | CDD:239353 | 17/59 (29%) |
GstA | 25..210 | CDD:223698 | 50/213 (23%) | ||
GST_C_Omega | 107..229 | CDD:198293 | 27/138 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589459 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |