DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstD11

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:184 Identity:85/184 - (46%)
Similarity:122/184 - (66%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAI 69
            ||||.|.||||:::.||.:.::...|::|:..||.|||:|:.:||||.:||:.|.|..|||||||
  Fly    28 YYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAI 92

  Fly    70 QVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAA 134
            ..|||..|||:|.|||...:.||:::|||.||:||||....:||:|.:|..||.|.....|:..|
  Fly    93 LSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRAKLAEA 157

  Fly   135 FEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAK 188
            ..:|||.|||:.::|.|..|:||:.|:.|||..|..:||:..|.::.:|.:..|
  Fly   158 VGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFELRPYKHIRQWLDRCK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 36/69 (52%)
GstA 4..185 CDD:223698 84/179 (47%)
GST_C_Delta_Epsilon 89..205 CDD:198287 41/100 (41%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 36/69 (52%)
GST_C_Delta_Epsilon 112..231 CDD:198287 41/100 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102842at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.