DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstD9

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:210 Identity:138/210 - (65%)
Similarity:172/210 - (81%) Gaps:2/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWE 65
            |:||||:..|:||||::|||:|:|:|||||.::|.|||||||||:|||||||||||||:|||:||
  Fly     1 MLDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWE 65

  Fly    66 SRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVF--AKAPADPEAF 128
            ||||.:||.|||.|..|||||.|::||||||||:||:.|||||:..|||||:|  .|.||||:..
  Fly    66 SRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNL 130

  Fly   129 KKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPG 193
            |||:.||...||.|:||.|||.:.||:||.||:|||||||:::::..||..|.|||:|||||.||
  Fly   131 KKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPG 195

  Fly   194 WEENWAGCLEFKKYF 208
            |||||.||..:||.:
  Fly   196 WEENWEGCEYYKKLY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 53/72 (74%)
GstA 4..185 CDD:223698 119/182 (65%)
GST_C_Delta_Epsilon 89..205 CDD:198287 72/117 (62%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 53/72 (74%)
GstA 4..187 CDD:223698 119/182 (65%)
GST_C_Delta_Epsilon 89..207 CDD:198287 72/117 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468459
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102842at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.