DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstZ2

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:175 Identity:40/175 - (22%)
Similarity:68/175 - (38%) Gaps:34/175 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKT 80
            :.|..|.:..::....|....||....|:.::||...:|.|..:|..|.||.||..|| |:....
  Fly    32 IAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYL-EETRPQ 95

  Fly    81 DSLYPKCPKKRAVINQRLYFDMGTLY----------------QSFANYYYPQVFAKAPADPEAFK 129
            ..|.|:...|||.:.:.:......:.                :.:|.::..:          .|:
  Fly    96 RPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITR----------GFR 150

  Fly   130 KIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEI 174
            .:|.|   |:|  ....|..||.:::||..||..|  |...:|.:
  Fly   151 AVEKA---LST--SAGKYCVGDEISMADCCLVPQV--FNARRFHV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 18/58 (31%)
GstA 4..185 CDD:223698 40/175 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 19/102 (19%)
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 18/58 (31%)
maiA 17..221 CDD:273527 40/175 (23%)
GST_C_Zeta 104..217 CDD:198300 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460366
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.