DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstZ1

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:183 Identity:47/183 - (25%)
Similarity:78/183 - (42%) Gaps:6/183 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FYYLPGSSPCR-SVIMTAKAVGVELN-KKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWES 66
            :.|.|.|...| .|.:..|.:..::. ..||...:|.....|:.::||...:|:|..:|..|.:|
  Fly    37 YSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCDS 101

  Fly    67 RAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKI 131
            .|| ::.:|:.....:|.|:.|.|||.|.:.:......: |...|........|..:...|...|
  Fly   102 VAI-IHYLEETRPQPALLPQDPVKRAKIREIVELICSGI-QPLQNVSVLDHIGKDQSLQWAQHWI 164

  Fly   132 EAAFEFLNTFL--EGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNR 182
            ...|:.|...|  ....:..||.|::|||.||..|......|.:::.|..:.|
  Fly   165 SRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKADLTPYPTIVR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 19/72 (26%)
GstA 4..185 CDD:223698 47/183 (26%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/96 (25%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 19/72 (26%)
maiA 35..240 CDD:273527 47/183 (26%)
GST_C_Zeta 122..236 CDD:198300 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.