DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and gstt1b

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:201 Identity:58/201 - (28%)
Similarity:95/201 - (47%) Gaps:29/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLV 74
            |.|||||.:.||...::.:.|.::|..|.....||.||||....||:.|..|.|.||.||.:||.
Zfish    11 SQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAESVAIMIYLA 75

  Fly    75 EKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYY-----PQVF-AKAPADPEAFKKIEA 133
            :|:...|..:|...:|||.:|:.|.:...::....|...:     |:|. |:.|.:     |:|.
Zfish    76 DKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPKE-----KMEN 135

  Fly   134 AFEFLNT--------FLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKV 190
            |.|.||.        ||:.:.:..||.:::||:..:..:.....|..::         :||..|:
Zfish   136 AEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDV---------FENRPKL 191

  Fly   191 TPGWEE 196
             ..|::
Zfish   192 -KAWKD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 28/64 (44%)
GstA 4..185 CDD:223698 54/188 (29%)
GST_C_Delta_Epsilon 89..205 CDD:198287 27/122 (22%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 58/201 (29%)
GST_N_Theta 3..78 CDD:239348 28/66 (42%)
GST_C_Theta 91..217 CDD:198292 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.