DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and gstt2

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:161 Identity:51/161 - (31%)
Similarity:78/161 - (48%) Gaps:9/161 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLV 74
            |.|||:|::..|...:....:.:.::.||...|||.|:||...:|.|.||||.|.||.||..||.
Zfish    15 SQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAILKYLA 79

  Fly    75 EKYGKTDSLYPKCPKKRAVINQ-RLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFL 138
            ..|...|..|||.|:|||.::: ..:..|.|...:...::...:.......|....|:|.|...|
Zfish    80 TTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAATVFWQEVLLPLMTGQPANTAKLEKALSDL 144

  Fly   139 --------NTFLEGQDYAAGDSLTVADIALV 161
                    |.||:.|.:..||.:::||:..:
Zfish   145 SGTLDKLENMFLKRQAFLCGDDISLADLLAI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 27/64 (42%)
GstA 4..185 CDD:223698 51/161 (32%)
GST_C_Delta_Epsilon 89..205 CDD:198287 18/82 (22%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 27/66 (41%)
GST_C_Theta 95..220 CDD:198292 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589527
Domainoid 1 1.000 50 1.000 Domainoid score I11638
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.