DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and se

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:170 Identity:38/170 - (22%)
Similarity:65/170 - (38%) Gaps:39/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KPEF-LKINPQHTIPTL----VDNGFALWESRAIQVYLVEKYGKTDSLYPKCPKKRA---VINQR 97
            |||: |:.|||..:|.|    ......|.||..|..||.|:| ....|||:.|.|:.   ::.:|
  Fly    57 KPEWLLEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQY-PLRPLYPRDPLKKVQDKLLIER 120

  Fly    98 LYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNTF-----LEGQDYAAGDSLTVAD 157
            ....:|..::           |....|.|.|      :..|:.:     ..|.::..|:...:.|
  Fly   121 FRAVLGAFFK-----------ASDGGDLEPF------WSGLDIYERELARRGTEFFGGEQTGILD 168

  Fly   158 IALVATVSTFEVAK--------FEISKYANVNRWYENAKK 189
            ..:.......|:.|        ::.|::..:..|.|..|:
  Fly   169 YMIWPWCERLELLKLQRGEDYNYDQSRFPQLTLWLERMKR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/38 (39%)
GstA 4..185 CDD:223698 36/164 (22%)
GST_C_Delta_Epsilon 89..205 CDD:198287 17/117 (15%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 14/37 (38%)
GstA 22..215 CDD:223698 38/170 (22%)
GST_C_Omega 109..229 CDD:198293 17/117 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.