DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstO3

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:204 Identity:51/204 - (25%)
Similarity:77/204 - (37%) Gaps:74/204 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VIMTAKAVGVELNKKLLNLQAGEHLKPEFL-KINPQHTIPTL---VDNGF-ALWESRAIQVYLVE 75
            :::.||  .|..:...:||..    |||:| :::|...:|.|   .:.|. :|.||..|..||.:
  Fly    38 LVLNAK--NVPYHSVYINLTE----KPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDD 96

  Fly    76 KYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNT 140
            ||.: :.|.||.|.|||.....|                           |.|..|.:|  |:|.
  Fly    97 KYPE-NPLLPKDPLKRAQDKILL---------------------------ERFSSITSA--FINI 131

  Fly   141 FLEG---QDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWEENWAGCL 202
            .::|   :||     .|..||             ||          .|..|:.||.:..|..|.:
  Fly   132 LVQGTGLEDY-----WTALDI-------------FE----------EELTKRGTPYFGGNKPGFV 168

  Fly   203 EFK--KYFE 209
            ::.  .:||
  Fly   169 DYMIWPWFE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 19/63 (30%)
GstA 4..185 CDD:223698 43/176 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/118 (20%)
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 18/62 (29%)
GstA 22..209 CDD:223698 51/204 (25%)
GST_C_Omega 109..230 CDD:198293 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.