DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstE5

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:215 Identity:80/215 - (37%)
Similarity:119/215 - (55%) Gaps:25/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAI 69
            |.:..|.|.|:|.:|..|:.:......:|:...|.|..|:||.||:||:|||.|:|..:|:|.||
  Fly     7 YGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAI 71

  Fly    70 QVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADP--------- 125
            ..|||.||..:|:|||:...:|||::|||:|:.|.:   |||      ..||...|         
  Fly    72 IAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVV---FAN------GIKAITKPLFFNGLNRI 127

  Fly   126 --EAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEIS--KYANVNRWYEN 186
              |.:..|...::|:.|||.|.||.|||.||:||.:|::::::. ||..||.  ||..:..|...
  Fly   128 PKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSL-VAFVEIDRLKYPRIIEWVRR 191

  Fly   187 AKKVTPGWEE-NWAGCLEFK 205
            .:|: |.:|| |..|..|.:
  Fly   192 LEKL-PYYEEANAKGARELE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 28/69 (41%)
GstA 4..185 CDD:223698 73/192 (38%)
GST_C_Delta_Epsilon 89..205 CDD:198287 45/129 (35%)
GstE5NP_611327.1 GstA 4..196 CDD:223698 74/199 (37%)
Thioredoxin_like 4..77 CDD:294274 28/69 (41%)
GST_C_Delta_Epsilon 91..209 CDD:198287 44/128 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460244
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.