DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstE3

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:208 Identity:87/208 - (41%)
Similarity:128/208 - (61%) Gaps:7/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAI 69
            |.:.||.|.|||::|.:|:.::.:.|::||...||||||||||||.||:|.|.||||.|.:|.||
  Fly     7 YGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAI 71

  Fly    70 QVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEA-FKKIEA 133
            ..|||.|||:.||||||..||||:::|||::|...:..:.....:|..:......|:| ...:|.
  Fly    72 NSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEG 136

  Fly   134 AFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEV-AKFEISKYANVNRWYENAKKVTPGWEE- 196
            .::.||.|||..:|.|||:||:||..::|.::.|.| ...:.:||..:..|.:..|:: |.:|| 
  Fly   137 VYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL-PYYEEA 200

  Fly   197 ---NWAGCLEFKK 206
               ..|..:||.|
  Fly   201 NGSRAAQIIEFIK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 38/69 (55%)
GstA 4..185 CDD:223698 79/181 (44%)
GST_C_Delta_Epsilon 89..205 CDD:198287 37/121 (31%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 80/188 (43%)
GST_N_Delta_Epsilon 4..77 CDD:239343 38/69 (55%)
GST_C_Delta_Epsilon 91..208 CDD:198287 36/117 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460239
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.