DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and GstE2

DIOPT Version :9

Sequence 1:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:205 Identity:78/205 - (38%)
Similarity:108/205 - (52%) Gaps:5/205 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAI 69
            |.:..|.|.|:..:|.:|:.::...|.::|.||:|.|..|||.|||||:|.|.|||..:|:|.||
  Fly     8 YGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAI 72

  Fly    70 QVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADP-EAFKKIEA 133
            ..|||:||..:|.|||:....||.::|||:||...|:.|..|...|....:....| |....|:.
  Fly    73 VCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNIKD 137

  Fly   134 AFEFLNTFLEGQDYAAGDSLTVADIALVATVSTF-EVAKFEISKYANVNRWYENAKKVTPGWEEN 197
            |:..|..||....|..|..||:||:...||.|:. .|...:..||..|..|:|...|:....|:|
  Fly   138 AYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYEEDN 202

  Fly   198 WAGCLEFKKY 207
            ..|   .|||
  Fly   203 LRG---LKKY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 31/69 (45%)
GstA 4..185 CDD:223698 70/181 (39%)
GST_C_Delta_Epsilon 89..205 CDD:198287 37/117 (32%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 72/187 (39%)
GST_N_Delta_Epsilon 5..78 CDD:239343 31/69 (45%)
GST_C_Delta_Epsilon 94..209 CDD:198287 38/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460241
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.